PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT08988
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 195aa    MW: 22424.5 Da    PI: 9.1555
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT08988genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1713.8e-53111391128
       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
               +ppGfrFhPt+eel+++yL+kkv++++++l +vi++vd++k+ePwd+++  k+ +  +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk++++   +
  EMT08988  11 VPPGFRFHPTEEELLNYYLRKKVASEEIDL-DVIRDVDLNKLEPWDIQEkcKIGSgPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAIYN-AVK 109
               69****************************.9***************952444443456**************************************.889 PP

       NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                +g++ktLvfykgrap+g+k+dW+mheyrl
  EMT08988 110 RIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 139
               9***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.24E-547146IPR003441NAC domain
PROSITE profilePS5100552.85111160IPR003441NAC domain
PfamPF023658.1E-2912139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MSISVNGQSC VPPGFRFHPT EEELLNYYLR KKVASEEIDL DVIRDVDLNK LEPWDIQEKC  60
KIGSGPQNDW YFFSHKDKKY PTGTRTNRAT AAGFWKATGR DKAIYNAVKR IGMRKTLVFY  120
KGRAPHGQKS DWIMHEYRLD DPSSTTDAAP TATMVRIRSP SSIGELMHRS PLIVCCRNNY  180
MEVWWCNDRS TSVLA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-47814314146NO APICAL MERISTEM PROTEIN
1ut4_B5e-47814314146NO APICAL MERISTEM PROTEIN
1ut7_A5e-47814314146NO APICAL MERISTEM PROTEIN
1ut7_B5e-47814314146NO APICAL MERISTEM PROTEIN
3swm_A5e-47814317149NAC domain-containing protein 19
3swm_B5e-47814317149NAC domain-containing protein 19
3swm_C5e-47814317149NAC domain-containing protein 19
3swm_D5e-47814317149NAC domain-containing protein 19
3swp_A5e-47814317149NAC domain-containing protein 19
3swp_B5e-47814317149NAC domain-containing protein 19
3swp_C5e-47814317149NAC domain-containing protein 19
3swp_D5e-47814317149NAC domain-containing protein 19
4dul_A5e-47814314146NAC domain-containing protein 19
4dul_B5e-47814314146NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2484490.0AK248449.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf176e18, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008648393.11e-102PREDICTED: NAC domain-containing protein 43-like
SwissprotQ84WP63e-94NAC43_ARATH; NAC domain-containing protein 43
TrEMBLM8C1B91e-148M8C1B9_AEGTA; NAC domain-containing protein 43
STRINGMLOC_66924.21e-108(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP159738112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.13e-82NAC family protein